CCL3 monoclonal antibody (M01), clone 4E7
  • CCL3 monoclonal antibody (M01), clone 4E7

CCL3 monoclonal antibody (M01), clone 4E7

Ref: AB-H00006348-M01
CCL3 monoclonal antibody (M01), clone 4E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL3.
Información adicional
Size 100 ug
Gene Name CCL3
Gene Alias G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6348
Clone Number 4E7
Iso type IgG2a Kappa

Enviar un mensaje


CCL3 monoclonal antibody (M01), clone 4E7

CCL3 monoclonal antibody (M01), clone 4E7