CCL3 polyclonal antibody (A01)
  • CCL3 polyclonal antibody (A01)

CCL3 polyclonal antibody (A01)

Ref: AB-H00006348-A01
CCL3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCL3.
Información adicional
Size 50 uL
Gene Name CCL3
Gene Alias G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6348

Enviar un mensaje


CCL3 polyclonal antibody (A01)

CCL3 polyclonal antibody (A01)