CCL1 monoclonal antibody (M02), clone 4E4
  • CCL1 monoclonal antibody (M02), clone 4E4

CCL1 monoclonal antibody (M02), clone 4E4

Ref: AB-H00006346-M02
CCL1 monoclonal antibody (M02), clone 4E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL1.
Información adicional
Size 100 ug
Gene Name CCL1
Gene Alias I-309|P500|SCYA1|SISe|TCA3
Gene Description chemokine (C-C motif) ligand 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6346
Clone Number 4E4
Iso type IgG2b Kappa

Enviar un mensaje


CCL1 monoclonal antibody (M02), clone 4E4

CCL1 monoclonal antibody (M02), clone 4E4